FOB Price
Get Latest Price1 ~ 6000 USD / Gram ( Negotiable )
|100 Milligram Minimum Order
Country:
China
Model No:
-
FOB Price:
1 ~ 6000 USD / Gram ( Negotiable ) Get Latest Price
Place of Origin:
Sichuan,China
Price for Minimum Order:
1 per Gram
Minimum Order Quantity:
100 Milligram
Packaging Detail:
-
Delivery Time:
within 30days
Supplying Ability:
100 Gram per Month
Payment Type:
T/T, Western Union, Other
Product Group :
-
Contact Person Ms. Cecilia
Jitai Rd, Chengdu, Sichuan
FOX 04DRI / Senolytics
FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.
FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.
| Country: | China |
| Model No: | - |
| FOB Price: | 1 ~ 6000 / Gram ( Negotiable ) Get Latest Price |
| Place of Origin: | Sichuan,China |
| Price for Minimum Order: | 1 per Gram |
| Minimum Order Quantity: | 100 Milligram |
| Packaging Detail: | - |
| Delivery Time: | within 30days |
| Supplying Ability: | 100 Gram per Month |
| Payment Type: | T/T, Western Union, Other |
| Product Group : | - |
